Return to main results Retrieve Phyre Job Id

Job DescriptionP39369
Confidence5.50%DateThu Jan 5 12:00:01 GMT 2012
Rank92Aligned Residues35
% Identity20%Templatec3nkuA_
PDB info PDB header:protein transportChain: A: PDB Molecule:drra; PDBTitle: crystal structure of the n-terminal domain of drra/sidm from2 legionella pneumophila
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   288.290.........300.........310.........320.........330....
Predicted Secondary structure 















Query SS confidence 














































Query Sequence  DEELLCVGSFNWFSATREDKYQRYDTSLVYRGEGVKNEIKAIYGSLD
Query Conservation 
     


 



    
   
 
  
 
        
      
 
Alig confidence 











............






















Template Conservation 
 









............






















Template Sequence  DXEVHFAGSSDL. . . . . . . . . . . . DAFVIVKNDEDIKKVKPVFDALN
Template Known Secondary structure  T





............
SST
Template Predicted Secondary structure 








............

Template SS confidence 














































   91........100.. .......110.........120.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions