Return to main results Retrieve Phyre Job Id

Job DescriptionP39369
Confidence6.04%DateThu Jan 5 12:00:01 GMT 2012
Rank87Aligned Residues22
% Identity32%Templatec3cseA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:dihydrofolate reductase; PDBTitle: candida glabrata dihydrofolate reductase complexed with2 nadph and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-3 ynyl)-6-ethylpyrimidine (ucp120b)
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   116...120....... ..130.......
Predicted Secondary structure 



........


Query SS confidence 











. . . . . . . .









Query Sequence  STILNVAVSRAK. . . . . . . . DSFLVFGDMD
Query Conservation     



 



........    
 
   
Alig confidence 











........









Template Conservation 
 
 





                 

 
Template Sequence  PKRINVVVSRSFDGELRKVEDGIYHSNSLR
Template Known Secondary structure  TTS
TTSSSS
TTS
Template Predicted Secondary structure 


















Template SS confidence 





























   70.........80.........90.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions