Return to main results Retrieve Phyre Job Id

Job DescriptionP64463
Confidence3.49%DateThu Jan 5 12:08:37 GMT 2012
Rank75Aligned Residues23
% Identity35%Templated1jw9b_
SCOP infoActivating enzymes of the ubiquitin-like proteins Activating enzymes of the ubiquitin-like proteins Molybdenum cofactor biosynthesis protein MoeB
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10 . ........20......
Predicted Secondary structure 






..
.......







Query SS confidence 






. .
. . . . . . .














Query Sequence  YDRNRNA. . I. . . . . . . TTGSRVMVSGTGHTG
Query Conservation 





 ..
.......  
 



 


  
Alig confidence 






..
.......














Template Conservation 
 


     
   
  
    
 


 

 
Template Sequence  YNRQIILRGFDFDGQEALKDSRVLIVGLGGLG
Template Known Secondary structure  TTSTTT


S
Template Predicted Secondary structure 






Template SS confidence 































   12.......20.........30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions