Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE60
Confidence2.88%DateThu Jan 5 11:22:35 GMT 2012
Rank31Aligned Residues24
% Identity33%Templated2pxyd2
SCOP infoMHC antigen-recognition domain MHC antigen-recognition domain MHC antigen-recognition domain
Resolution2.23

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70.....
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  GKYVAFVLMGESFLRSPAFTVPESAQRWANQIRQE
Query Conservation 


































Alig confidence 











...........











Template Conservation 




 



  ........... 

 


  

 
Template Sequence  GEYRAVTELGRP. . . . . . . . . . . DAEYYNKQYLER
Template Known Secondary structure  TSSGGG...........T
Template Predicted Secondary structure 





...........

Template SS confidence 


































   45....50...... ...60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions