Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE60
Confidence3.28%DateThu Jan 5 11:22:35 GMT 2012
Rank28Aligned Residues33
% Identity18%Templatec3r27A_
PDB info PDB header:protein bindingChain: A: PDB Molecule:heterogeneous nuclear ribonucleoprotein l; PDBTitle: crystal structure of the first rrm domain of heterogeneous nuclear2 ribonucleoprotein l (hnrnp l)
Resolution2.04 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70......
Predicted Secondary structure 












Query SS confidence 










































Query Sequence  RDVWMLRGKYVAFVLMGESFLRSPAFTVPESAQRWANQIRQEG
Query Conservation 










































Alig confidence 

















..........














Template Conservation             


 
  ..........   
  
        
Template Sequence  SYVVVMPKKRQALVEFED. . . . . . . . . . VLGACNAVNYAADNQ
Template Known Secondary structure  TTTTSS..........S
Template Predicted Secondary structure 



..........



Template SS confidence 










































   129130.........140...... ...150.........160.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions