Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABC9
Confidence6.73%DateThu Jan 5 11:15:11 GMT 2012
Rank92Aligned Residues29
% Identity10%Templatec3o5cA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:cytochrome c551 peroxidase; PDBTitle: cytochrome c peroxidase bccp of shewanella oneidensis
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   628.630.........640.........650.........660......
Predicted Secondary structure 













Query SS confidence 






































Query Sequence  FLLEGSQGNDLMDYSKEQVITDILDQYERHLNFIHLHRE
Query Conservation      
   

         
 


 


  
  
     
Alig confidence 








..........



















Template Conservation 
 


   
..........
 


           

  
Template Sequence  YFHDGSVWT. . . . . . . . . . LEEAVNTMADIQLGQKLTEK
Template Known Secondary structure  BTTTT
B
S..........S



Template Predicted Secondary structure 








..........







Template SS confidence 






































   263......270. ........280.........290.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions