Return to main results Retrieve Phyre Job Id

Job DescriptionP62601
Confidence35.59%DateThu Jan 5 12:07:39 GMT 2012
Rank32Aligned Residues33
% Identity21%Templatec2q07A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein af0587; PDBTitle: crystal structure of af0587, a protein of unknown function
Resolution2.04 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   158.160.........170.........180.........190.........200..
Predicted Secondary structure 




















Query SS confidence 












































Query Sequence  LPQSYIVPGGRFSETYYWDSYFTMLGLAESGREDLLKCMADNFAW
Query Conservation   
   








 







  


 
     
  

 

  
Alig confidence 







..









..........














Template Conservation   


 


..



  


 ..........

       
  


Template Sequence  ISSPLVVP. . REFELLHWSE. . . . . . . . . . EEVSFVAGWLKRFIE
Template Known Secondary structure 
SS
..GGGTT



..........
Template Predicted Secondary structure 






..



..........
Template SS confidence 












































   294.....300. ........310. ........320......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions