Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFG0
Confidence8.50%DateThu Jan 5 11:26:08 GMT 2012
Rank93Aligned Residues25
% Identity16%Templatec2k52A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein mj1198; PDBTitle: structure of uncharacterized protein mj1198 from2 methanocaldococcus jannaschii. northeast structural3 genomics target mjr117b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   128.130.........140.........150.........160..
Predicted Secondary structure 















Query SS confidence 


































Query Sequence  FEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSV
Query Conservation     
  


  


 
  
 
  
      
 
 
Alig confidence 







..........
















Template Conservation     
  
 ..........  
  

    

 


Template Sequence  LNVGDEII. . . . . . . . . . VQAIDVRPEKREIDFKY
Template Known Secondary structure 

TT
..........TTTT
Template Predicted Secondary structure 




..........



Template SS confidence 


































   46...50... ......60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions