Return to main results Retrieve Phyre Job Id

Job DescriptionP37051
Confidence39.14%DateThu Jan 5 11:54:42 GMT 2012
Rank193Aligned Residues25
% Identity32%Templatec3c0fB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:uncharacterized protein af_1514; PDBTitle: crystal structure of a novel non-pfam protein af1514 from archeoglobus2 fulgidus dsm 4304 solved by s-sad using a cr x-ray source
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50......
Predicted Secondary structure 








Query SS confidence 






























Query Sequence  ICYKHELNIVQNNEFVDHRTGRFFMRTELEG
Query Conservation   
   
 

    
  
     






  
Alig confidence 















......








Template Conservation 















......








Template Sequence  YACNRGANLISVNQFE. . . . . . FYFRIEVEG
Template Known Secondary structure  TT



TT......


Template Predicted Secondary structure 




......

Template SS confidence 






























   62.......70....... ..80......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions