Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACV2
Confidence5.42%DateThu Jan 5 11:19:08 GMT 2012
Rank82Aligned Residues26
% Identity27%Templatec3jxeB_
PDB info PDB header:ligaseChain: B: PDB Molecule:tryptophanyl-trna synthetase; PDBTitle: crystal structure of pyrococcus horikoshii tryptophanyl-trna2 synthetase in complex with trpamp
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   111........120.........130 ......
Predicted Secondary structure 




.......



Query SS confidence 



















. . . . . . .





Query Sequence  EGLDNLKRAQMQNRGVMVVG. . . . . . . VHFMSL
Query Conservation   
 
 
      
 


  
....... 
 


Alig confidence 



















.......





Template Conservation 

 
 

     
 
  



  


 




 
Template Sequence  RDYDLILKDYEEGRGFFLYTGRGPSGPMHIGHI
Template Known Secondary structure  STT




SS

B
Template Predicted Secondary structure 














Template SS confidence 
































   5960.........70.........80.........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions