Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACV2
Confidence9.31%DateThu Jan 5 11:19:08 GMT 2012
Rank35Aligned Residues26
% Identity15%Templatec2ip1A_
PDB info PDB header:ligaseChain: A: PDB Molecule:tryptophanyl-trna synthetase; PDBTitle: crystal structure analysis of s. cerevisiae tryptophanyl trna2 synthetase
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   111........120.........130 . .....
Predicted Secondary structure 




.......
.


Query SS confidence 



















. . . . . . .
.




Query Sequence  EGLDNLKRAQMQNRGVMVVG. . . . . . . V. HFMSL
Query Conservation   
 
 
      
 


  
....... .
 


Alig confidence 



















.......
.




Template Conservation 

   

          



  


  




 
Template Sequence  RDFTKILDLYEQGKPFFLYTGRGPSSDSMHLGHM
Template Known Secondary structure  ST





SS

BGGG
Template Predicted Secondary structure 














Template SS confidence 

































   141........150.........160.........170....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions