Return to main results Retrieve Phyre Job Id

Job DescriptionP71241
Confidence77.43%DateThu Jan 5 12:12:36 GMT 2012
Rank187Aligned Residues45
% Identity20%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   144.....150.. .......160.........170.........180.........190.........200.........
Predicted Secondary structure 


.























Query SS confidence 








.
























































Query Sequence  KRMVAVAGD. LAAGQMLMESFRNQPWLGFEVVGVYHDPKPGGVSNDWAGNLQQLVEDAKAGKIHNVY
Query Conservation    






.
     
   
         


 


         


    
   
    

 

Alig confidence 








.













...






..................














Template Conservation   









 

  
   
   ...
  
   .................. 
   
     
 

Template Sequence  NRRVLVTGATGLLGRAVHKEFQQN. . . NWHAVGC. . . . . . . . . . . . . . . . . . GVHHIIHDFQPHVIV
Template Known Secondary structure 

TTTSTT...T
..................



S
Template Predicted Secondary structure 






...

..................



Template SS confidence 


































































   28.30.........40.........50. ....... .60.........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions