Return to main results Retrieve Phyre Job Id

Job DescriptionP27431
Confidence93.32%DateThu Jan 5 11:43:58 GMT 2012
Rank121Aligned Residues57
% Identity18%Templatec3myxA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein pspto_0244; PDBTitle: crystal structure of a pspto_0244 (protein with unknown function which2 belongs to pfam duf861 family) from pseudomonas syringae pv. tomato3 str. dc3000 at 1.30 a resolution
Resolution1.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   128.130.........140.........150.........160.........170.........180.........190.........200......
Predicted Secondary structure 






































Query SS confidence 














































































Query Sequence  QYDVFIIQGTGRRRWRVGEKLQMKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPN
Query Conservation    
 
  
  
 
 
 
                            
 


 



 
  
       
   
      
Alig confidence 



















......................




































Template Conservation    

   



   

  
 ......................      

   

 
    
      
          
Template Sequence  PYTEXLVXHRGSVTLTSGTD. . . . . . . . . . . . . . . . . . . . . . SVTLSTGESAVIGRGTQVRIDAQPESLWAFCASTQAS
Template Known Secondary structure  SSSTT......................TT

TT


TT
S

Template Predicted Secondary structure 





......................















Template SS confidence 














































































   63......70.........80.. .......90.........100.........110.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions