Return to main results Retrieve Phyre Job Id

Job DescriptionP27431
Confidence96.34%DateThu Jan 5 11:43:58 GMT 2012
Rank101Aligned Residues68
% Identity16%Templatec3bcwB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a duf861 family protein with a rmlc-like cupin2 fold (bb1179) from bordetella bronchiseptica rb50 at 1.60 a3 resolution
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   111........120.........130.........140.........150.........160.........170.........180.........190
Predicted Secondary structure 







































Query SS confidence 















































































Query Sequence  LMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQMKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGY
Query Conservation          
 
   
 
  
 
  
  
 
 
 
                            
 


 



 
  
   
Alig confidence 









.


























.....................




















Template Conservation   
 
   

 .         
   



   
   

 .....................   
 


    
 
    
 
Template Sequence  SGVWESTSGS. FQSNTTGYIEYCHIIEGEARLVDPDGT. . . . . . . . . . . . . . . . . . . . . VHAVKAGDAFIXPEGYTGRWE
Template Known Secondary structure  .


TT
TT

.....................TT

TT


Template Predicted Secondary structure 



.










.....................








Template SS confidence 















































































   50......... 60.........70.........80...... ...90.........100.......
 
   191... .....200
Predicted Secondary structure 


.
Query SS confidence 



.





Query Sequence  ALEN. AMNYSV
Query Conservation      .
   
 
Alig confidence 



.





Template Conservation    
  

 


Template Sequence  VDRHVKKIYFV
Template Known Secondary structure 
Template Predicted Secondary structure 


Template SS confidence 










   108.110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions