Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACG1
Confidence7.22%DateThu Jan 5 11:18:06 GMT 2012
Rank66Aligned Residues38
% Identity18%Templated1iqpa1
SCOP infopost-AAA+ oligomerization domain-like post-AAA+ oligomerization domain-like DNA polymerase III clamp loader subunits, C-terminal domain
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40.........50.........60.........70.......
Predicted Secondary structure 



Query SS confidence 


















































Query Sequence  EEMLEKFRVVTKERREEEEQQQRELAERQEKISTWLELMKADGINPEELLG
Query Conservation    
  

   
 
   
         

   
  
       


  

  
Alig confidence 











.............

























Template Conservation   

  

   
 .............     
   
  
    
 
  


 
Template Sequence  EDIREMMLLALK. . . . . . . . . . . . . GNFLKAREKLREILLKQGLSGEDVLV
Template Known Secondary structure  .............T



Template Predicted Secondary structure  .............





Template SS confidence 


















































   237..240........ .250.........260.........270....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions