Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACG1
Confidence13.37%DateThu Jan 5 11:18:06 GMT 2012
Rank32Aligned Residues56
% Identity11%Templated1brwa1
SCOP infoMethionine synthase domain-like Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70........
Predicted Secondary structure 







Query SS confidence 













































































Query Sequence  MSVMLQSLNNIRTLRAMAREFSIDVLEEMLEKFRVVTKERREEEEQQQRELAERQEKISTWLELMKADGINPEELLGN
Query Conservation 

     
   
 

   
 

  

  
  

   
 
   
         

   
  
       


  

   
Alig confidence 










.......














...............





























Template Conservation      
 
   
.......  

  
       
...............  
  

 





 

  



 


 
 
Template Sequence  MVDLIAKKRDG. . . . . . . KALTKEEIEWIVRGY. . . . . . . . . . . . . . . TNGDIPDYQMSALAMAIYFRGMTEEETAAL
Template Known Secondary structure  TT.......



...............TTSS



Template Predicted Secondary structure 

.......



...............








Template SS confidence 













































































   3......10... ......20........ .30.........40.........50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions