Return to main results Retrieve Phyre Job Id

Job DescriptionP64429
Confidence76.12%DateThu Jan 5 12:08:15 GMT 2012
Rank43Aligned Residues28
% Identity32%Templated1c7ka_
SCOP infoZincin-like Metalloproteases ("zincins"), catalytic domain Zinc protease
Resolution1.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   134.....140.........150.........160.........170.
Predicted Secondary structure 








Query SS confidence 





































Query Sequence  PADGTVYIDLSFYDDMKDKLGADGDFAQGYVIAHEVGH
Query Conservation 
 
 


 
  
   
    
  

 
   







Alig confidence 








...


.



......











Template Conservation   
 
 
  
...   . 


......   





 

Template Sequence  HGRGYIFLD. . . YQQ. NQQY. . . . . . DSTRVTAHETGH
Template Known Secondary structure  SS
....S......
Template Predicted Secondary structure 


...
.



......

Template SS confidence 





































   60........ .70. .... ....80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions