Return to main results Retrieve Phyre Job Id

Job DescriptionP64429
Confidence89.71%DateThu Jan 5 12:08:15 GMT 2012
Rank8Aligned Residues35
% Identity31%Templated1bqba_
SCOP infoZincin-like Metalloproteases ("zincins"), catalytic domain Thermolysin-like
Resolution1.72

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   164.....170.........180.........190.........200.........210
Predicted Secondary structure 



Query SS confidence 














































Query Sequence  VIAHEVGHHVQKLLGIEPKVRQLQQNATQAEVNRLSVRMELQADCFA
Query Conservation 










 
 


                 



 







Alig confidence 









.........
















...







Template Conservation 

 

  


.........
    

 
  





...
  


 
Template Sequence  VVAHEITHGV. . . . . . . . . TQQTANLEYKDQSGALN. . . ESFSDVFG
Template Known Secondary structure  .........TT


SS...
Template Predicted Secondary structure  .........











...
Template SS confidence 














































   141........150 .........160....... ..170.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions