Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6T5
Confidence8.32%DateThu Jan 5 11:03:53 GMT 2012
Rank59Aligned Residues23
% Identity17%Templatec2vg2C_
PDB info PDB header:transferaseChain: C: PDB Molecule:undecaprenyl pyrophosphate synthetase; PDBTitle: rv2361 with ipp
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   123...... 130.........140.....
Predicted Secondary structure 
...............


Query SS confidence 






. . . . . . . . . . . . . . .















Query Sequence  TVAYIPK. . . . . . . . . . . . . . . DSVIGLSKINRIVQFF
Query Conservation 





 ...............  










   
Alig confidence 






...............















Template Conservation 












   

    

  
   
  

 

Template Sequence  HVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGA
Template Known Secondary structure 


TT

Template Predicted Secondary structure 






Template SS confidence 





































   70.........80.........90.........100.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions