Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6T5
Confidence26.97%DateThu Jan 5 11:03:53 GMT 2012
Rank13Aligned Residues25
% Identity20%Templatec2d2rA_
PDB info PDB header:transferaseChain: A: PDB Molecule:undecaprenyl pyrophosphate synthase; PDBTitle: crystal structure of helicobacter pylori undecaprenyl pyrophosphate2 synthase
Resolution1.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   123......130 .........140.......
Predicted Secondary structure 

...............


Query SS confidence 







. . . . . . . . . . . . . . .
















Query Sequence  TVAYIPKD. . . . . . . . . . . . . . . SVIGLSKINRIVQFFAQ
Query Conservation 





  ............... 










   

Alig confidence 







...............
















Template Conservation 


 






 
   
     

  
   
  

 

  
Template Sequence  HLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCAN
Template Known Secondary structure 


TTT

T
Template Predicted Secondary structure 






Template SS confidence 







































   7..10.........20.........30.........40......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions