Return to main results Retrieve Phyre Job Id

Job DescriptionP76097
Confidence43.39%DateThu Jan 5 12:18:52 GMT 2012
Rank23Aligned Residues33
% Identity15%Templatec3jw4C_
PDB info PDB header:transcription regulatorChain: C: PDB Molecule:transcriptional regulator, marr/emrr family; PDBTitle: the structure of a putative marr family transcriptional regulator from2 clostridium acetobutylicum
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   296...300.........310.........320.........330.......
Predicted Secondary structure 













Query SS confidence 









































Query Sequence  VALTPKGRQLYDDLLRNAGTGQDNLTHQMHLQETFRTFPDSE
Query Conservation   


 


 


 

  
            
   
  



 
Alig confidence 
















.........















Template Conservation 
 

  
          .........           

 

Template Sequence  IYVLPKGAALVEEFNNI. . . . . . . . . FLEVEESITKGLTKDE
Template Known Secondary structure 
.........TT

Template Predicted Secondary structure 
.........



Template SS confidence 









































   98.100.........110.... .....120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions