Return to main results Retrieve Phyre Job Id

Job DescriptionP76097
Confidence16.53%DateThu Jan 5 12:18:52 GMT 2012
Rank84Aligned Residues25
% Identity28%Templatec3fwbB_
PDB info PDB header:cell cycle, transcriptionChain: B: PDB Molecule:nuclear mrna export protein sac3; PDBTitle: sac3:sus1:cdc31 complex
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   303......310.........320.........330.........340..
Predicted Secondary structure 









Query SS confidence 







































Query Sequence  RQLYDDLLRNAGTGQDNLTHQMHLQETFRTFPDSEFLMRQ
Query Conservation 
 


 

  
            
   
  



   

 
Alig confidence 









...............














Template Conservation   


 




...............
  
    
 
 
  
Template Sequence  RELYDAFLHE. . . . . . . . . . . . . . . RLYLIYMDSRAELKR
Template Known Secondary structure  ...............
Template Predicted Secondary structure  ...............

Template SS confidence 







































   766...770..... ....780.........790
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions