Return to main results Retrieve Phyre Job Id

Job DescriptionP76097
Confidence32.00%DateThu Jan 5 12:18:52 GMT 2012
Rank41Aligned Residues33
% Identity18%Templatec3ecoB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:mepr; PDBTitle: crystal structure of mepr, a transcription regulator of the2 staphylococcus aureus multidrug efflux pump mepa
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   298.300.........310.........320.........330.........
Predicted Secondary structure 











Query SS confidence 









































Query Sequence  LTPKGRQLYDDLLRNAGTGQDNLTHQMHLQETFRTFPDSEFL
Query Conservation 

 


 


 

  
            
   
  



   
Alig confidence 














.........

















Template Conservation 

  
          .........           
  

  
Template Sequence  LTTSGIKLVEAFTSI. . . . . . . . . FDEMEQTLVSQLSEEENE
Template Known Secondary structure 
T.........TTS
Template Predicted Secondary structure  .........



Template SS confidence 









































   93......100....... ..110.........120.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions