Return to main results Retrieve Phyre Job Id

Job DescriptionP76097
Confidence54.73%DateThu Jan 5 12:18:52 GMT 2012
Rank9Aligned Residues33
% Identity18%Templatec2nyxB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:probable transcriptional regulatory protein, rv1404; PDBTitle: crystal structure of rv1404 from mycobacterium tuberculosis
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   296...300.........310.........320.........330.......
Predicted Secondary structure 













Query SS confidence 









































Query Sequence  VALTPKGRQLYDDLLRNAGTGQDNLTHQMHLQETFRTFPDSE
Query Conservation   


 


 


 

  
            
   
  



 
Alig confidence 
















.........















Template Conservation 
 

  
          .........        
  
   
Template Sequence  AALTKRGRDVVRQVTEH. . . . . . . . . RRTEIARIVEQXAPAE
Template Known Secondary structure 
.........TTS
GGG
Template Predicted Secondary structure 


.........



Template SS confidence 









































   103......110......... 120.........130.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions