Return to main results Retrieve Phyre Job Id

Job DescriptionP60584
Confidence5.47%DateThu Jan 5 12:06:55 GMT 2012
Rank98Aligned Residues35
% Identity29%Templatec3c1lB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:putative antioxidant defense protein mlr4105; PDBTitle: crystal structure of an antioxidant defense protein (mlr4105) from2 mesorhizobium loti maff303099 at 2.00 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.
Predicted Secondary structure 












Query SS confidence 














































Query Sequence  LNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKALADMGI
Query Conservation 

     
                
   
     
      
   

Alig confidence 

















............
















Template Conservation      
 


  
      ............   
       
   
 
Template Sequence  LSPRQTAXLEFAVKLTEE. . . . . . . . . . . . PAKIVEADRAALRKAGF
Template Known Secondary structure 


............GGG

TT
Template Predicted Secondary structure 


............







Template SS confidence 














































   115....120.........130.. .......140.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions