Return to main results Retrieve Phyre Job Id

Job DescriptionP46119
Confidence1.82%DateWed Jan 25 15:20:56 GMT 2012
Rank73Aligned Residues30
% Identity33%Templated1u6ka1
SCOP infoF420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD)
Resolution1.55

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90...
Predicted Secondary structure 

















Query SS confidence 






































Query Sequence  LMLPAAVVVILQVAKRLAPQLMNRPPQYSRSEREKDNDA
Query Conservation 






 



 
  


 
             
  
 
Alig confidence 

















.........











Template Conservation 











 

 

.........










 
Template Sequence  VPIVASAHEXXRKAAELA. . . . . . . . . DEARELEKSNDA
Template Known Secondary structure  .........TT
Template Predicted Secondary structure 
.........

Template SS confidence 






































   231........240........ .250.........260
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions