Return to main results Retrieve Phyre Job Id

Job DescriptionP46119
Confidence2.14%DateWed Jan 25 15:20:56 GMT 2012
Rank57Aligned Residues21
% Identity24%Templated1gvna_
SCOP infoimmunoglobulin/albumin-binding domain-like Plasmid maintenance system epsilon/zeta, antidote epsilon subunit Plasmid maintenance system epsilon/zeta, antidote epsilon subunit
Resolution1.95

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   60.........70.........80.........
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  AVVVILQVAKRLAPQLMNRPPQYSRSEREK
Query Conservation 

 



 
  


 
             
Alig confidence 












.........







Template Conservation 









 
 ......... 

  
 
Template Sequence  AVHEYWRSMNRYS. . . . . . . . . KQVLNKEK
Template Known Secondary structure  .........




Template Predicted Secondary structure  .........



Template SS confidence 





























   68.70.........80 ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions