Return to main results Retrieve Phyre Job Id

Job DescriptionP76549
Confidence2.45%DateThu Jan 5 12:24:26 GMT 2012
Rank25Aligned Residues36
% Identity22%Templatec2khzB_
PDB info PDB header:nuclear proteinChain: B: PDB Molecule:c-myc-responsive protein rcl; PDBTitle: solution structure of rcl
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40...... ...50.........60.......
Predicted Secondary structure 

............




Query SS confidence 














. . . . . . . . . . . .




















Query Sequence  VNYEEPLPMELANYG. . . . . . . . . . . . EPGEGAKIMNAAKIMGRDYAW
Query Conservation      
 
    
  
............
  
  
   
  
 


 

Alig confidence 














............




















Template Conservation       

   
   
 


 

        
         
   
   
Template Sequence  QALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNW
Template Known Secondary structure  SSGGGTTTTSSS

STTSTT
Template Predicted Secondary structure 
















Template SS confidence 















































   225....230.........240.........250.........260.........270..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions