Return to main results Retrieve Phyre Job Id

Job DescriptionP14407
Confidence10.03%DateThu Jan 5 11:34:03 GMT 2012
Rank100Aligned Residues26
% Identity31%Templated1iaka2
SCOP infoMHC antigen-recognition domain MHC antigen-recognition domain MHC antigen-recognition domain
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40...
Predicted Secondary structure 



















Query SS confidence 






































Query Sequence  PFIYQAPFPMGKDNTEYYLLTSDYVSVADFDGETILKVE
Query Conservation                                         
Alig confidence 











.............













Template Conservation    



  



.............
 






 
 

Template Sequence  ITVYQSPGDIGQ. . . . . . . . . . . . . YTFEFDGDELFYVD
Template Known Secondary structure  TTTT.............TT
Template Predicted Secondary structure 






.............


Template SS confidence 






































   10.........20. ........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions