Return to main results Retrieve Phyre Job Id

Job DescriptionP14407
Confidence15.04%DateThu Jan 5 11:34:03 GMT 2012
Rank51Aligned Residues45
% Identity31%Templatec3eeqB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:putative cobalamin biosynthesis protein g PDBTitle: crystal structure of a putative cobalamin biosynthesis2 protein g homolog from sulfolobus solfataricus
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   467..470.........480.........490.........500.........510.........520.........530..
Predicted Secondary structure 






















Query SS confidence 

































































Query Sequence  SQQVTDACHKHGGFYLGSIGGPAAVLAQQSIKHLECVAYPELGMEAIWKIEVEDFPAFILVDDKGN
Query Conservation        
 

 




 



 

 

   

  
 
   


 


  






 

 


 

Alig confidence 
































....................
.










Template Conservation     
 
 
   
  


 
 




 


    ....................
.







 
 
Template Sequence  DAEIETIWKCYDAIVFVMALEGATRIVCKYAKE. . . . . . . . . . . . . . . . . . . . D. PAIVCIDDKIN
Template Known Secondary structure  T


SS



....................
.

TT

Template Predicted Secondary structure 







....................
.





Template SS confidence 

































































   51........60.........70.........80... . .....90.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions