Return to main results Retrieve Phyre Job Id

Job DescriptionP07363
Confidence22.90%DateThu Jan 5 11:00:16 GMT 2012
Rank119Aligned Residues21
% Identity24%Templatec3zr6A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:galactocerebrosidase; PDBTitle: structure of galactocerebrosidase from mouse in complex with2 galactose
Resolution2.44 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   447..450.........460.........470.........
Predicted Secondary structure 



















Query SS confidence 
































Query Sequence  DDEVAMLIFAPGFSTAEQVTDVSGRGVGMDVVK
Query Conservation    
    

 
 


        
 



 


Alig confidence 










............









Template Conservation 
  


 

  ............  
 





Template Sequence  RSEILDYLFKP. . . . . . . . . . . . NFGASLHILK
Template Known Secondary structure  ST............TTSS

S
Template Predicted Secondary structure 


............


Template SS confidence 
































   63......70... ......80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions