Return to main results Retrieve Phyre Job Id

Job DescriptionP39358
Confidence40.04%DateThu Jan 5 11:59:48 GMT 2012
Rank15Aligned Residues19
% Identity53%Templated2npta1
SCOP infobeta-Grasp (ubiquitin-like) CAD & PB1 domains PB1 domain
Resolution1.75

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   562.......570.........580.........590.........600..
Predicted Secondary structure 
















Query SS confidence 








































Query Sequence  RTGDLIEIKIDCRELHGEVNFLGTRSDEQLPSQEEATAILN
Query Conservation   


 
 


  
 
   
   
        
 

 
 

 
Alig confidence 








......................









Template Conservation 








......................




 



Template Sequence  EDGDRITVR. . . . . . . . . . . . . . . . . . . . . . SDEEMKAMLS
Template Known Secondary structure  TTS

......................S
Template Predicted Secondary structure 



......................
Template SS confidence 








































   65....70... ......80...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions