Return to main results Retrieve Phyre Job Id

Job DescriptionP39358
Confidence15.14%DateThu Jan 5 11:59:48 GMT 2012
Rank92Aligned Residues48
% Identity25%Templatec3i18A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:lmo2051 protein; PDBTitle: crystal structure of the pdz domain of the sdrc-like protein2 (lmo2051) from listeria monocytogenes, northeast structural3 genomics consortium target lmr166b
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   540.........550.........560.........570.........580.........590.........600......
Predicted Secondary structure 



























Query SS confidence 


































































Query Sequence  STGACIGHVGPEALAGGPIGKLRTGDLIEIKIDCRELHGEVNFLGTRSDEQLPSQEEATAILNARPS
Query Conservation 
 
  








 






 


 
 


  
 
   
   
        
 

 
 

 

  
Alig confidence 

















...






.







....
...........













Template Conservation    

 
  
   


   ...
  

 
.
 


  
.... ...........    
   
     
Template Sequence  YDGVYVXSVKDDVPAADV. . . LHAGDLI. TEIDGNAF. . . . K. . . . . . . . . . . SSQEFIDYIHSKKV
Template Known Secondary structure 



TTSGGGGT...

TT
.TTB

....S...........STS
T
Template Predicted Secondary structure 





...




.


....
...........




Template SS confidence 


































































   6...10.........20... ......30 ........ . 40.........50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions