Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8D0
Confidence73.59%DateThu Jan 5 11:07:30 GMT 2012
Rank19Aligned Residues31
% Identity29%Templatec1nuiA_
PDB info PDB header:replicationChain: A: PDB Molecule:dna primase/helicase; PDBTitle: crystal structure of the primase fragment of bacteriophage t7 primase-2 helicase protein
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40..
Predicted Secondary structure 























Query SS confidence 







































Query Sequence  CPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFE
Query Conservation 

 
      
 


    
  




 
  
  



 
Alig confidence 












....





.....











Template Conservation 

 

  
   
 .... 

   .....

 

       
Template Sequence  CDNCGSSDGNSLF. . . . SDGHTF. . . . . CYVCEKWTATKE
Template Known Secondary structure 
SSS

SS
....TTS
.....TTT



Template Predicted Secondary structure 









....



.....











Template SS confidence 







































   17..20......... 30..... ....40.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions