Return to main results Retrieve Phyre Job Id

Job DescriptionP19642
Confidence8.90%DateThu Jan 5 11:37:27 GMT 2012
Rank49Aligned Residues42
% Identity24%Templatec3e6qL_
PDB info PDB header:isomeraseChain: L: PDB Molecule:putative 5-carboxymethyl-2-hydroxymuconate isomerase; PDBTitle: putative 5-carboxymethyl-2-hydroxymuconate isomerase from pseudomonas2 aeruginosa.
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   427..430.........440.........450.........460.........470.........480....
Predicted Secondary structure 























Query SS confidence 

























































Query Sequence  PGRDSEVASSIEKAVAGAPGKSGYNVPAILEALGGADNIVSLDNCITRLRLSVKDMSL
Query Conservation 



                        

  


  

     
 



  
 
   
Alig confidence 









..............








..






















Template Conservation   


 
 
  ..............
   
   
..           
 




 


 
Template Sequence  DGRDAATRQA. . . . . . . . . . . . . . LGESLCEVL. . AGAVAGGGEEGVQVSVEVREXER
Template Known Secondary structure  TT

................
BSS


G
Template Predicted Secondary structure 



................








Template SS confidence 

























































   70......... 80........ .90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions