Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADZ0
Confidence17.98%DateThu Jan 5 11:22:07 GMT 2012
Rank64Aligned Residues29
% Identity34%Templatec2o37A_
PDB info PDB header:chaperoneChain: A: PDB Molecule:protein sis1; PDBTitle: j-domain of sis1 protein, hsp40 co-chaperone from2 saccharomyces cerevisiae.
Resolution1.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50
Predicted Secondary structure 














Query SS confidence 

















































Query Sequence  MIREERLLKVLRAPHVSEKASTAMEKSNTIVLKVAKDATKAEIKAAVQKL
Query Conservation           


 

 



  
 
  
 
 
 
   


 


 


  
Alig confidence 










.....................

















Template Conservation 
    
 
 

.....................

   

   

 


  
Template Sequence  MVKETKLYDLL. . . . . . . . . . . . . . . . . . . . . GVSPSANEQELKKGYRKA
Template Known Secondary structure 

S

.....................T

TT

Template Predicted Secondary structure 





.....................






Template SS confidence 

















































   1........10. ........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions