Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABX8
Confidence1.86%DateThu Jan 5 11:16:40 GMT 2012
Rank45Aligned Residues24
% Identity17%Templatec3ku7B_
PDB info PDB header:cell cycleChain: B: PDB Molecule:cell division topological specificity factor; PDBTitle: crystal structure of helicobacter pylori mine, a cell division2 topological specificity factor
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   120.........130.........140.........150
Predicted Secondary structure 






Query SS confidence 






























Query Sequence  KNLIAEIKTTLSTPLVAGQPKQDVTDVLYTA
Query Conservation    
  

   

  
        
  
 

 
Alig confidence 















.......







Template Conservation 


 



 






.......  


  
Template Sequence  EEMRKEIIAVIQKYTK. . . . . . . SSDIHFKT
Template Known Secondary structure  TT
.......

Template Predicted Secondary structure 

.......



Template SS confidence 






























   36...40.........50. ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions