Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD99
Confidence3.51%DateThu Jan 5 11:20:24 GMT 2012
Rank18Aligned Residues22
% Identity27%Templated1v54l_
SCOP infoSingle transmembrane helix Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.......
Predicted Secondary structure 





Query SS confidence 

































Query Sequence  QLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQA
Query Conservation        

  
 


  









  

  
Alig confidence 







...









.........



Template Conservation   
 

  
...

     


.........

  
Template Sequence  SVENKWRL. . . LAMMTLFFGS. . . . . . . . . GFAA
Template Known Secondary structure 

SS............
Template Predicted Secondary structure 


............
Template SS confidence 

































   14.....20. ........30. ....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions