Return to main results Retrieve Phyre Job Id

Job DescriptionP41070
Confidence2.09%DateThu Jan 5 12:01:26 GMT 2012
Rank39Aligned Residues25
% Identity24%Templated1ixha_
SCOP infoPeriplasmic binding protein-like II Periplasmic binding protein-like II Phosphate binding protein-like
Resolution0.98

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  DFMHAVLSNCATRIVLPAPEKFGSESLPDN
Query Conservation 

   




 




             
Alig confidence 








.




....










Template Conservation   

   

 .

  
....   





  
Template Sequence  KFFDWAYKT. GAKQA. . . . NDLDYASLPDS
Template Known Secondary structure  .
....TT


Template Predicted Secondary structure  .....






Template SS confidence 





























   275....280... ..... .290.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions