Return to main results Retrieve Phyre Job Id

Job DescriptionP39321
Confidence30.81%DateThu Jan 5 11:59:20 GMT 2012
Rank5Aligned Residues29
% Identity17%Templated1p4ta_
SCOP infoTransmembrane beta-barrels OMPA-like Outer membrane protein
Resolution2.55

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12291230.........1240......... 1250.......
Predicted Secondary structure 






...............
Query SS confidence 




















. . . . . . . . . . . . . . .







Query Sequence  LTLRYRLMPKLYLEAVSGVDQ. . . . . . . . . . . . . . . ALDLLYQF
Query Conservation      
 
              ...............   
 
  
Alig confidence 




















...............







Template Conservation   
  
 

        


                   

 
 
Template Sequence  TGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
Template Known Secondary structure  TTTT
Template Predicted Secondary structure 














Template SS confidence 











































   112.......120.........130.........140.........150.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions