Return to main results Retrieve Phyre Job Id

Job DescriptionP39321
Confidence4.97%DateThu Jan 5 11:59:20 GMT 2012
Rank46Aligned Residues29
% Identity21%Templatec3a2rX_
PDB info PDB header:membrane proteinChain: X: PDB Molecule:outer membrane protein ii; PDBTitle: crystal structure of outer membrane protein porb from neisseria2 meningitidis
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12291230.........1240......... 1250.......
Predicted Secondary structure 






.............
Query SS confidence 




















. . . . . . . . . . . . .







Query Sequence  LTLRYRLMPKLYLEAVSGVDQ. . . . . . . . . . . . . ALDLLYQF
Query Conservation      
 
              .............   
 
  
Alig confidence 




















.............







Template Conservation 

  
 




  
                     



  
Template Sequence  VGADYDFSKRTSALVSAGWLKQGKGAGKVEQTASMVGLRHKF
Template Known Secondary structure  SSSSSSTTS

Template Predicted Secondary structure 













Template SS confidence 









































   300.........310.........320.........330.........340.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions