Return to main results Retrieve Phyre Job Id

Job DescriptionP39321
Confidence3.73%DateThu Jan 5 11:59:20 GMT 2012
Rank69Aligned Residues29
% Identity31%Templatec2iwvD_
PDB info PDB header:ion channelChain: D: PDB Molecule:outer membrane protein g; PDBTitle: structure of the monomeric outer membrane porin ompg in the2 open and closed conformation
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12291230.........1240........ .1250.......
Predicted Secondary structure 





..............
Query SS confidence 



















. . . . . . . . . . . . . .








Query Sequence  LTLRYRLMPKLYLEAVSGVD. . . . . . . . . . . . . . QALDLLYQF
Query Conservation      
 
             ..............    
 
  
Alig confidence 



















..............








Template Conservation      
 
     
  
  

  
   


       


 


Template Sequence  LFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSF
Template Known Secondary structure 
SSSSSS


Template Predicted Secondary structure 











Template SS confidence 










































   238.240.........250.........260.........270.........280
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions