Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB18
Confidence27.36%DateThu Jan 5 11:14:23 GMT 2012
Rank51Aligned Residues41
% Identity29%Templated2ezha_
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like Recombinase DNA-binding domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   38.40.........50.........60.........70.........80.........90.........100.....
Predicted Secondary structure 
























Query SS confidence 



































































Query Sequence  SLSPEHWEVVRFVRDFYLEFNTSPAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKP
Query Conservation 



 

 

 


  
 
    
  
 
 
             
 

 


 

 
 
 







Alig confidence 






...










.











.......................










Template Conservation        
...
 
   

   . 

       
 .......................  
   

  
Template Sequence  EFDEDAW. . . QFLIADYLRPE. KPAFRKCYERLE. . . . . . . . . . . . . . . . . . . . . . . LAAREHGWSIP
Template Known Secondary structure 


...TSTT.


.......................T



Template Predicted Secondary structure 


...


.


.......................





Template SS confidence 



































































   179180..... ....190...... ...200........ .210.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions