Return to main results Retrieve Phyre Job Id

Job DescriptionP76514
Confidence40.19%DateThu Jan 5 12:23:54 GMT 2012
Rank22Aligned Residues22
% Identity36%Templatec3u1nC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:sam domain and hd domain-containing protein 1; PDBTitle: structure of the catalytic core of human samhd1
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60. ........70
Predicted Secondary structure 
....................
Query SS confidence 












. . . . . . . . . . . . . . . . . . . .








Query Sequence  QHAVLCSQLVPQE. . . . . . . . . . . . . . . . . . . . FAFEALMHD
Query Conservation 



         ....................  
  



Alig confidence 












....................








Template Conservation 





 


      
        
       
 






Template Sequence  EHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHD
Template Known Secondary structure 
GGG


TT
Template Predicted Secondary structure 







Template SS confidence 









































   166...170.........180.........190.........200.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions