Return to main results Retrieve Phyre Job Id

Job DescriptionP76514
Confidence28.53%DateThu Jan 5 12:23:54 GMT 2012
Rank27Aligned Residues22
% Identity41%Templatec2o6iA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:hd domain protein; PDBTitle: structure of an enterococcus faecalis hd domain phosphohydrolase
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60. ........70
Predicted Secondary structure 
.........................
Query SS confidence 












. . . . . . . . . . . . . . . . . . . . . . . . .








Query Sequence  QHAVLCSQLVPQE. . . . . . . . . . . . . . . . . . . . . . . . . FAFEALMHD
Query Conservation 



         .........................  
  



Alig confidence 












.........................








Template Conservation 





  

      
                     
  





Template Sequence  SHSLGVYEITRRICEIFQRNYSVERLGENGWNDDERLITLCAALLHD
Template Known Secondary structure  SBGGGSB
GGGTT
Template Predicted Secondary structure 











Template SS confidence 














































   65....70.........80.........90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions