Return to main results Retrieve Phyre Job Id

Job DescriptionP76069
Confidence3.66%DateThu Jan 5 12:18:08 GMT 2012
Rank81Aligned Residues25
% Identity20%Templated1hdma2
SCOP infoMHC antigen-recognition domain MHC antigen-recognition domain MHC antigen-recognition domain
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70.........80.........
Predicted Secondary structure 













Query SS confidence 






























Query Sequence  LKDWKGVGELVNGVEVALEYTAERGIALLKQ
Query Conservation 






 
   
    
 



 
 


 
Alig confidence 





...



...














Template Conservation     

 ...

  ... 
  
 


 
  
 
Template Sequence  FADWAQ. . . EQGD. . . AILFDKEFCEWMIQQ
Template Known Secondary structure  GGGGTT...



...
Template Predicted Secondary structure 





...

...
Template SS confidence 






























   5960.... .... .70.........80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions