Return to main results Retrieve Phyre Job Id

Job DescriptionP76069
Confidence10.03%DateThu Jan 5 12:18:08 GMT 2012
Rank18Aligned Residues40
% Identity8%Templatec4a69C_
PDB info PDB header:transcriptionChain: C: PDB Molecule:nuclear receptor corepressor 2; PDBTitle: structure of hdac3 bound to corepressor and inositol tetraphosphate
Resolution2.06 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90......
Predicted Secondary structure 

















Query SS confidence 





















































Query Sequence  VDSVDDLLIDNAARYLLKDWKGVGELVNGVEVALEYTAERGIALLKQNPELYWQ
Query Conservation      




   
 








 
   
    
 



 
 


 
 
  
  
Alig confidence 















.














.............








Template Conservation 
 

   
       
.
 
  

     

 ............. 
    

 
Template Sequence  SEQEKETFREKFMQHP. KNFGLIASFLERKTV. . . . . . . . . . . . . AECVLYYYL
Template Known Secondary structure 
ST.T
T
TT

.............
Template Predicted Secondary structure 

.






.............
Template SS confidence 





















































   433......440........ .450.........460... ......470..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions