Return to main results Retrieve Phyre Job Id

Job DescriptionP76069
Confidence7.65%DateThu Jan 5 12:18:08 GMT 2012
Rank30Aligned Residues36
% Identity11%Templatec2eqrA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:nuclear receptor corepressor 1; PDBTitle: solution structure of the first sant domain from human2 nuclear receptor corepressor 1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90......
Predicted Secondary structure 














Query SS confidence 

















































Query Sequence  DDLLIDNAARYLLKDWKGVGELVNGVEVALEYTAERGIALLKQNPELYWQ
Query Conservation 




   
 








 
   
    
 



 
 


 
 
  
  
Alig confidence 











.














.............








Template Conservation     
       
.  
  

     

 .............      

 
Template Sequence  KEIFKDKFIQHP. KNFGLIASYLERKSV. . . . . . . . . . . . . PDCVLYYYL
Template Known Secondary structure  ST.T

TTS
.............
Template Predicted Secondary structure 
.






.............
Template SS confidence 

















































   20.........30. ........40...... ...50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions