Return to main results Retrieve Phyre Job Id

Job DescriptionP22255
Confidence4.79%DateThu Jan 5 11:38:47 GMT 2012
Rank85Aligned Residues42
% Identity10%Templatec3lo7A_
PDB info PDB header:transferaseChain: A: PDB Molecule:penicillin-binding protein a; PDBTitle: crystal structure of pbpa from mycobacterium tuberculosis
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.........50.........60.........70.........80.......
Predicted Secondary structure 

























Query SS confidence 
























































Query Sequence  KADNSPVTAADIAAHTVIMDGLRTLTPDVPVLSEEDPPGWEVRQHWQRYWLVDPLDG
Query Conservation 
 
 
 

 

   
  
   
    
   




              







Alig confidence 

























...............















Template Conservation    
  
 



  

  

 

    ...............     

 

 
  

Template Sequence  LRGGNVDTTINPRIQQAGWDAMQQGC. . . . . . . . . . . . . . . YGPCKGAVVALEPSTG
Template Known Secondary structure 






BT...............TB



TTT
Template Predicted Secondary structure 







...............







Template SS confidence 
























































   115....120.........130.........140 .........150......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions