Return to main results Retrieve Phyre Job Id

Job DescriptionP0A817
Confidence8.10%DateThu Jan 5 11:06:38 GMT 2012
Rank92Aligned Residues25
% Identity44%Templatec3d4oA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:dipicolinate synthase subunit a; PDBTitle: crystal structure of dipicolinate synthase subunit a (np_243269.1)2 from bacillus halodurans at 2.10 a resolution
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   241........250.........260.........270.........280....
Predicted Secondary structure 





















Query SS confidence 











































Query Sequence  GLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAK
Query Conservation 













   



















 

 


Alig confidence 










...................













Template Conservation     
 

 


...................

      
  
  
Template Sequence  XLTGKHVVIIG. . . . . . . . . . . . . . . . . . . GDARQLEIIRKLST
Template Known Secondary structure 

TT

...................B
Template Predicted Secondary structure 





...................

Template SS confidence 











































   1........10. ........20.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions